PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.8G116200.1.p
Common NamePRUPE_ppa006812mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 395aa    MW: 44024.3 Da    PI: 7.7942
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.8G116200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.65.9e-33258313156
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                         k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Prupe.8G116200.1.p 258 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 313
                         79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-30255316IPR009057Homeodomain-like
SuperFamilySSF466892.19E-18255316IPR009057Homeodomain-like
PROSITE profilePS5129414.318255315IPR017930Myb domain
TIGRFAMsTIGR015572.6E-27258313IPR006447Myb domain, plants
PfamPF002496.1E-8260311IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MGSVPPELSL DFRPTFVPKT ISDFLKEVSM IGSVSERLSK LDDFVKRLEE EMRKIDAFKR  60
ELPLCMFLLN DAILALKEDA VQCAAPNVQP VLEEFIPLKK DCEKNNGGTN NNKKEKDCRD  120
KKNWMSSVQL WNTDNYQHPS SDFPYDRKQV SEIDSKRNEA ENGLANEDPF QTCRNRTAGR  180
AFMPFKTYPA FSVTAARKED KEELPVHGLS LLTPGIKNPK EESASSGSRS TCGRAVSFST  240
ANAQSNMRTP PQQPTSRKQR RCWSPELHRR FVNALQQLGG SQVATPKQIR ELMQVDGLTN  300
DEVKSHLQKY RLHTRRVPAA TAAPDNQSVV VLGGLWMSQD QYADSSKASS SQSGSPQGPL  360
HLTGTGGDDE DDEDAKSESY SWKGHIQKSG KNDV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007201075.10.0hypothetical protein PRUPE_ppa006812mg
TrEMBLM5VM720.0M5VM72_PRUPE; Uncharacterized protein
STRINGVIT_03s0063g01060.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-57G2-like family protein